General Information

  • ID:  hor005541
  • Uniprot ID:  P91963
  • Protein name:  Pigment-dispersing hormone
  • Gene name:  PDH1
  • Organism:  Penaeus vannamei (Whiteleg shrimp) (Litopenaeus vannamei)
  • Family:  Arthropod PDH family
  • Source:  animal
  • Expression:  Eyestalk.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Penaeus (genus), Penaeidae (family), Penaeoidea (superfamily), Dendrobranchiata (suborder), Decapoda (order), Eucarida (superorder), Eumalacostraca (subclass), Malacostraca (class), Multicrustacea (superclass), Crustacea (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction; GO:0007268 chemical synaptic transmission; GO:0009416 response to light stimulus
  • GO CC:  GO:0005576 extracellular region; GO:0045202 synapse

Sequence Information

  • Sequence:  NSELINSLLGIPKVMNDA
  • Length:  18(59-76)
  • Propeptide:  MRSAVVVALLVMVAMSLQLTAAQEDLKYFEREVVAELAAQILRVAQGPSAFVAGPHKRNSELINSLLGIPKVMNDAGRR
  • Signal peptide:  MRSAVVVALLVMVAMSLQLTAA
  • Modification:  T18 Alanine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  causes the migration of the distal retinal pigment into the proximal end of the pigment chromatophore cells and thus decreases the amount of light entering the retinulas. May also function as a neurotransmitter and/or neuromodulator
  • Mechanism:  The function of PDH precursor-related peptide is unknown. The sequence is not well-conserved among different species and that might be an indication that it is inactive.
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P91963-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor005541_AF2.pdbhor005541_ESM.pdb

Physical Information

Mass: 223165 Formula: C83H142N22O28S
Absent amino acids: CFHQRTWY Common amino acids: LN
pI: 4.18 Basic residues: 1
Polar residues: 6 Hydrophobic residues: 7
Hydrophobicity: 18.33 Boman Index: -1406
Half-Life: 1.4 hour Half-Life Yeast: 3 min
Half-Life E.Coli: >10 hour Aliphatic Index 130
Instability Index: 811.11 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  8630031
  • Title:  Molecular cloning of the precursors of pigment-dispersing hormone in Crustaceans.